Rabbit Anti-Presenilin 2 Loop Region
Affinity purified rabbit polyclonal antibody raised against Presenilin 2 Loop Region.
Specifications
Physical State:
Liquid
Storage:
-20°C (long term), 2 – 8°C (short term)
Buffer:
Learn more Lyophilized from PBS, pH 7.4. Contains no preservative
Lead time on this item is currently: 2-4 Weeks
Need help? Ask a Specialist Contact UsOR +1 (800) 643-3426
Product Overview
Isotype IgG.
| Host Species: | Rabbit |
|---|---|
| Clonality: | Polyclonal |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) matching human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid. |
| Immunogen Species: | Human |
| Species Reactivity: | Human, Mouse |
| Molecular Weight: | 22 kDa, 45 kDa (See application details.) |
| Purification: | IgG |
| Physical State: | Liquid |
| Buffer: | Lyophilized from PBS, pH 7.4. Contains no preservative |
| Specificity: | Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1. |
| Application Notes: | Recommended starting dilutions: WB 1:1000; IP 1:100. |
| Storage Conditions: | -20°C (long term), 2 – 8°C (short term) |
| Handling: | Keep a working aliquot at 2 – 8°C for short-term use. Spin the vial down before opening. Reconstitute in 500 µL sterile-filtered 1X PBS, pH 7 before use. |
| Shipping Conditions: | Dry ice |
| Expiration: | Stable for 12 months from receipt (unopened). |
Product Applications
- Western blot
- Immunofluorescence (IF/ICC)
- Neuroscience research