Guinea Pig Anti-Agouti Related Protein (AGRP)

Affinity purified guinea pig polyclonal antibody raised against Agouti Related Protein (AGRP).

Specifications

Physical State:
Liquid
Storage:
-20°C (long term), 2 – 8°C (short term)
Learn more

Product code: AGPAGP-50UL

Unit price$347.00
Add to Quote

Lead time on this item is currently: 2-4 Weeks

Need help? Ask a Specialist Contact UsOR +1 (800) 643-3426

Product Overview

Host Species: Guinea Pig
Clonality: Polyclonal
Isotype: Mixed
Immunogen: A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) matching a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
Immunogen Species: Mouse
Species Reactivity: Human, Mouse, Rat, Sheep
Purification: Whole serum (unpurified antiserum)
Physical State: Liquid
Specificity: Specificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.
Application Notes: Recommended starting dilution: IHC 1:1000 – 1:2000.
Storage Conditions: -20°C (long term), 2 – 8°C (short term)
Handling: Supplied in 50% glycerol, so aliquots can be drawn at -20°C without thawing the stock. Keep a working aliquot at 2 – 8°C for short-term use. Spin the vial down before opening. Reconstitute in 50 µL sterile-filtered, ultrapure water before use.
Shipping Conditions: Dry ice
Expiration: Stable for 12 months from receipt (unopened).

Product Applications

  • Western blot
  • Immunohistochemistry
  • Neuroscience research
Documents & Datasheets

Certificate of Analysis