Guinea Pig Anti-Agouti Related Protein (AGRP)
Affinity purified guinea pig polyclonal antibody raised against Agouti Related Protein (AGRP).
Lead time on this item is currently: 2-4 Weeks
Need help? Ask a Specialist Contact UsOR +1 (800) 643-3426
Product Overview
| Host Species: | Guinea Pig |
|---|---|
| Clonality: | Polyclonal |
| Isotype: | Mixed |
| Immunogen: | A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) matching a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response. |
| Immunogen Species: | Mouse |
| Species Reactivity: | Human, Mouse, Rat, Sheep |
| Purification: | Whole serum (unpurified antiserum) |
| Physical State: | Liquid |
| Specificity: | Specificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested. |
| Application Notes: | Recommended starting dilution: IHC 1:1000 – 1:2000. |
| Storage Conditions: | -20°C (long term), 2 – 8°C (short term) |
| Handling: | Supplied in 50% glycerol, so aliquots can be drawn at -20°C without thawing the stock. Keep a working aliquot at 2 – 8°C for short-term use. Spin the vial down before opening. Reconstitute in 50 µL sterile-filtered, ultrapure water before use. |
| Shipping Conditions: | Dry ice |
| Expiration: | Stable for 12 months from receipt (unopened). |
Product Applications
- Western blot
- Immunohistochemistry
- Neuroscience research