Chicken Anti-GluA2/GluR2 Glutamate Receptor (Recombinant Chimeric FL550 Conjugate)
Chicken monoclonal antibody to human, mouse and rat GluA2/GluR2 glutamate receptor, purified by affinity chromatography.
Specifications
Physical State:
Liquid
Storage:
-20°C or below (long term), 2 – 8°C (short term)
Buffer:
PBS, 0.05% Sodium Azide pH 7.4
Release criteria
Protein Concentration:
0.3 – 0.5 mg/mL (lot dependent)
Lead time on this item is currently: 2-4 Weeks

Need help? Ask a Specialist Contact UsOR +1 (800) 643-3426
Product Overview
KO validated.
| Host Species: | Chicken |
|---|---|
| Clonality: | Recombinant Monoclonal |
| Clone: | L21/32 |
| Isotype: | IgY |
| Conjugate: | FL550 (Ex 550 nm / Em 575 nm) |
| Immunogen: | Recombinant fusion protein spanning residues 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminal region) of rat GluA2/GluR2, expressed in E. coli. |
| Immunogen Species: | Rat |
| Species Reactivity: | Human, Mouse, Rat |
| Gene Name: | Gria2 Glur2 |
| Molecular Weight: | 90 kDa |
| Purification: | Affinity-purified |
| Physical State: | Liquid |
| Buffer: | PBS, 0.05% Sodium Azide pH 7.4 |
| Protein Concentration: | 0.3 – 0.5 mg/mL (lot dependent) |
| Specificity: | Shows no cross-reactivity with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results). |
| Application Notes: | Recommended starting dilutions: IHC 1:250 – 1:500; ICC 1:500. |
| Testing: | Each lot is QC-tested by Western blot on rat brain membrane fraction for a band at the expected molecular weight. |
| Storage Conditions: | -20°C or below (long term), 2 – 8°C (short term) |
| Handling: | Aliquot on receipt. Keep a working aliquot at 2 – 8°C for short-term use. Spin the vial down before opening. |
| Shipping Conditions: | Dry ice |
| Expiration: | Stable for 24 months from receipt. |
Product Applications
- Western blot
- Immunohistochemistry
- Immunofluorescence (IF/ICC)
- Neuroscience research