Chicken Anti-GluA2/GluR2 Glutamate Receptor (Recombinant Chimeric FL550 Conjugate)

Chicken monoclonal antibody to human, mouse and rat GluA2/GluR2 glutamate receptor, purified by affinity chromatography.

Specifications

Physical State:
Liquid
Storage:
-20°C or below (long term), 2 – 8°C (short term)
Buffer:
PBS, 0.05% Sodium Azide pH 7.4

Release criteria

Protein Concentration:
0.3 – 0.5 mg/mL (lot dependent)
Learn more

Product code: ACKGR2IYRCV1CJ-200UL

Unit price$562.00
Add to Quote

Lead time on this item is currently: 2-4 Weeks

Need help? Ask a Specialist Contact UsOR +1 (800) 643-3426

Product Overview

KO validated.

Host Species: Chicken
Clonality: Recombinant Monoclonal
Clone: L21/32
Isotype: IgY
Conjugate: FL550 (Ex 550 nm / Em 575 nm)
Immunogen: Recombinant fusion protein spanning residues 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminal region) of rat GluA2/GluR2, expressed in E. coli.
Immunogen Species: Rat
Species Reactivity: Human, Mouse, Rat
Gene Name: Gria2 Glur2
Molecular Weight: 90 kDa
Purification: Affinity-purified
Physical State: Liquid
Buffer: PBS, 0.05% Sodium Azide pH 7.4
Protein Concentration: 0.3 – 0.5 mg/mL (lot dependent)
Specificity: Shows no cross-reactivity with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results).
Application Notes: Recommended starting dilutions: IHC 1:250 – 1:500; ICC 1:500.
Testing: Each lot is QC-tested by Western blot on rat brain membrane fraction for a band at the expected molecular weight.
Storage Conditions: -20°C or below (long term), 2 – 8°C (short term)
Handling: Aliquot on receipt. Keep a working aliquot at 2 – 8°C for short-term use. Spin the vial down before opening.
Shipping Conditions: Dry ice
Expiration: Stable for 24 months from receipt.

Product Applications

  • Western blot
  • Immunohistochemistry
  • Immunofluorescence (IF/ICC)
  • Neuroscience research
Documents & Datasheets

Certificate of Analysis